PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04886g04001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 391aa    MW: 41547.8 Da    PI: 9.3761
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04886g04001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.4e-3879139363
                    zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                               e+alkcprC+s+ntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGg++r+nk+sss
  Niben101Scf04886g04001.1  79 ETALKCPRCESSNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGSCRRNKRSSS 139
                               6789*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3066129IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3281136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.30182136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MVFSSIPAYL DPANWQQQSG GSIPNHHQFT SPLSQTATPP PVPPPPPPLQ PHGSGGGAGS  60
IRPGSMADRA RLANIPMPET ALKCPRCESS NTKFCYFNNY SLSQPRHFCK TCRRYWTRGG  120
ALRNVPVGGS CRRNKRSSSK SNNNNNNNTS KSPASSTSTD SRQAANNNSG STSTISSHSN  180
SFSGPTSADS LLGLMSSRIP PLRFLSPLGQ LTDHHHHQFS TPVNNMNFST SGNVLGGTSE  240
GMMVNNNNLL GAGANVGAGA GGGVASLSSS VNVEHWRMQQ QMAHQFPNFL GGFDPSNLPS  300
GICSYQFQGG VNEGVQFLGG NESTTSQIRP KISTSMLNQM ASVKMEDNNH NQDQSALSRQ  360
LLGIQGNENW NTACAWSDLS ASFSSSTSNA L
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009758525.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_016465077.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLM1AHM91e-143M1AHM9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000230331e-142(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.13e-40DNA binding with one finger 2.4